diff --git a/api/__init__.py b/api/__init__.py index 4fd05ca3..f074861a 100644 --- a/api/__init__.py +++ b/api/__init__.py @@ -57,6 +57,7 @@ def create_app(): eplant_tomato_db.init_app(bar_app) poplar_nssnp_db.init_app(bar_app) tomato_nssnp_db.init_app(bar_app) + tomato_seq_db.init_app(bar_app) single_cell_db.init_app(bar_app) summarization_db.init_app(bar_app) @@ -83,6 +84,7 @@ def create_app(): from api.resources.proxy import bar_proxy from api.resources.thalemine import thalemine from api.resources.snps import snps + from api.resources.sequence import sequence bar_api.add_namespace(gene_information) bar_api.add_namespace(rnaseq_gene_expression) @@ -91,6 +93,7 @@ def create_app(): bar_api.add_namespace(bar_proxy) bar_api.add_namespace(thalemine) bar_api.add_namespace(snps) + bar_api.add_namespace(sequence) bar_api.init_app(bar_app) return bar_app @@ -104,6 +107,7 @@ def create_app(): eplant_tomato_db = SQLAlchemy(metadata=MetaData()) poplar_nssnp_db = SQLAlchemy(metadata=MetaData()) tomato_nssnp_db = SQLAlchemy(metadata=MetaData()) +tomato_seq_db = SQLAlchemy(metadata=MetaData()) single_cell_db = SQLAlchemy(metadata=MetaData()) summarization_db = SQLAlchemy(metadata=MetaData()) diff --git a/api/models/tomato_seq.py b/api/models/tomato_seq.py new file mode 100644 index 00000000..589734d6 --- /dev/null +++ b/api/models/tomato_seq.py @@ -0,0 +1,13 @@ +from api import tomato_seq_db as db + + +class Sequence(db.Model): + __bind_key__ = "tom_sequence" + __tablename__ = "tom_3_2_sequence_info" + + gene_id = db.Column(db.String(20), nullable=False, primary_key=True) + full_seq = db.Column(db.String(9999), nullable=True, primary_key=False) + full_seq_len = db.Column(db.Integer(), nullable=True, primary_key=False) + phyre_2_seq = db.Column(db.String(9999), nullable=True, primary_key=False) + phyre2_seq_start = db.Column(db.Integer(), nullable=True, primary_key=False) + phyre2_seq_end = db.Column(db.Integer(), nullable=True, primary_key=False) diff --git a/api/resources/sequence.py b/api/resources/sequence.py new file mode 100644 index 00000000..78d82b83 --- /dev/null +++ b/api/resources/sequence.py @@ -0,0 +1,50 @@ +""" +Date: Apr 2021 +Author: Vince L +Sequence endpoint that returns the amino acid sequence of a given protein, with additional options +for predicted sequences (Phyre2) that we host +""" +from flask_restx import Namespace, Resource +from api.utils.bar_utils import BARUtils +from markupsafe import escape +from sqlalchemy.exc import OperationalError +from api.models.tomato_seq import Sequence as tom_seq + +sequence = Namespace("Sequence", description="Sequence API", path="/sequence") + + +@sequence.route("//") +class Sequence(Resource): + @sequence.param("species", _in="path", default="tomato") + @sequence.param("gene_id", _in="path", default="Solyc00g005445.1.1") + def get(self, species="", gene_id=""): + """ + Endpoint returns sequence for a given gene of a particular species + Species Supported: + - Tomato (ITAG3.2) - e.g. Solyc00g005445.1.1 + """ + + species = escape(species.lower()) + gene_id = escape(gene_id.capitalize()) + + if species == "tomato": + if BARUtils.is_tomato_gene_valid(gene_id, True): + try: + rows = tom_seq.query.filter_by(gene_id=gene_id).all() + if len(rows) == 0: + return BARUtils.error_exit("There are no data found for the given gene"), 400 + else: + return { + "gene_id" : rows[0].gene_id, + "sequence": rows[0].full_seq, + "length": rows[0].full_seq_len, + "phyre_2_seq": rows[0].phyre_2_seq, + "phyre2_seq_start": rows[0].phyre2_seq_start, + "phyre2_seq_end": rows[0].phyre2_seq_end + } + except OperationalError: + return BARUtils.error_exit("An internal error has occurred"), 500 + else: + return BARUtils.error_exit("Invalid gene id"), 400 + else: + return BARUtils.error_exit("Invalid species"), 400 diff --git a/api/resources/snps.py b/api/resources/snps.py index d8b5ce04..f92e041f 100644 --- a/api/resources/snps.py +++ b/api/resources/snps.py @@ -26,13 +26,17 @@ class Phenix(Resource): @snps.param("fixed_pdb", _in="path", default="Potri.016G107900.1") @snps.param("moving_pdb", _in="path", default="AT5G01040.1") def get(self, fixed_pdb="", moving_pdb=""): - """This end point returns the superimposition of the moving PDB onto moving PDB in PDB format""" + """ + This end point returns the superimposition of the moving PDB onto the fixed PDB (returns a URL to fetch PDB) + Enter valid species identifier for proteins of interest + """ fixed_pdb = escape(fixed_pdb) moving_pdb = escape(moving_pdb) arabidopsis_pdb_path = "/var/www/html/eplant_legacy/java/Phyre2-Models/Phyre2_" poplar_pdb_path = "/var/www/html/eplant_poplar/pdb/" + tomato_pdb_path = 'TODO: ASHER PLS LINK TO SERVERS PUBLIC TOMATO DIR' # TODO: Asher phenix_pdb_link = "//bar.utoronto.ca/phenix-pdbs/" phenix_pdb_path = "/var/www/html/phenix-pdbs/" @@ -43,6 +47,8 @@ def get(self, fixed_pdb="", moving_pdb=""): fixed_pdb_path = ( poplar_pdb_path + BARUtils.format_poplar(fixed_pdb) + ".pdb" ) + elif BARUtils.is_tomato_gene_valid(fixed_pdb, True): + fixed_pdb_path = tomato_pdb_path + fixed_pdb.capitalize() + ".pdb" else: return BARUtils.error_exit("Invalid fixed pdb gene id"), 400 @@ -52,6 +58,8 @@ def get(self, fixed_pdb="", moving_pdb=""): moving_pdb_path = ( poplar_pdb_path + BARUtils.format_poplar(moving_pdb) + ".pdb" ) + elif BARUtils.is_tomato_gene_valid(moving_pdb, True): + moving_pdb_path = tomato_pdb_path + moving_pdb.capitalize() + ".pdb" else: return BARUtils.error_exit("Invalid moving pdb gene id"), 400 diff --git a/config/BAR_API.cfg b/config/BAR_API.cfg index a2e4d9c3..60a8dfe1 100644 --- a/config/BAR_API.cfg +++ b/config/BAR_API.cfg @@ -17,7 +17,8 @@ SQLALCHEMY_BINDS = { 'poplar_nssnp' : 'mysql://root:root@localhost/poplar_nssnp', 'tomato_nssnp' : 'mysql://root:root@localhost/tomato_nssnp', 'eplant_poplar' : 'mysql://root:root@localhost/eplant_poplar', - 'eplant_tomato' : 'mysql://root:root@localhost/eplant_tomato' + 'eplant_tomato' : 'mysql://root:root@localhost/eplant_tomato', + 'tom_sequence' : 'mysql://root:root@localhost/tom_sequence' } ## API Manager variables diff --git a/config/databases/tomato_seq.sql b/config/databases/tomato_seq.sql new file mode 100644 index 00000000..bcd3f8ea --- /dev/null +++ b/config/databases/tomato_seq.sql @@ -0,0 +1,45 @@ +-- MySQL Script generated by MySQL Workbench +-- Tue Apr 12 12:02:42 2021 +-- Model: New Model Version: 1.0 +-- MySQL Workbench Forward Engineering + +SET @OLD_UNIQUE_CHECKS=@@UNIQUE_CHECKS, UNIQUE_CHECKS=0; +SET @OLD_FOREIGN_KEY_CHECKS=@@FOREIGN_KEY_CHECKS, FOREIGN_KEY_CHECKS=0; +SET @OLD_SQL_MODE=@@SQL_MODE, SQL_MODE='ONLY_FULL_GROUP_BY,STRICT_TRANS_TABLES,NO_ZERO_IN_DATE,NO_ZERO_DATE,ERROR_FOR_DIVISION_BY_ZERO,NO_ENGINE_SUBSTITUTION'; + +-- ----------------------------------------------------- +-- Schema +-- ----------------------------------------------------- +CREATE DATABASE IF NOT EXISTS `tom_sequence` DEFAULT CHARACTER SET utf8 ; + +USE `tom_sequence` ; + +-- ----------------------------------------------------- +-- Table ``.`tom_3_2_sequence_info` +-- ----------------------------------------------------- +DROP TABLE IF EXISTS `tom_3_2_sequence_info` ; + +CREATE TABLE IF NOT EXISTS `tom_3_2_sequence_info` ( + `gene_id` VARCHAR(20) NOT NULL, + `full_seq` VARCHAR(9999) NULL, + `full_seq_len` INT NULL, + `phyre_2_seq` VARCHAR(9999) NULL, + `phyre2_seq_start` INT NULL, + `phyre2_seq_end` INT NULL, + PRIMARY KEY (`gene_id`)) +ENGINE=InnoDB DEFAULT CHARSET=latin1; + + +SET SQL_MODE=@OLD_SQL_MODE; +SET FOREIGN_KEY_CHECKS=@OLD_FOREIGN_KEY_CHECKS; +SET UNIQUE_CHECKS=@OLD_UNIQUE_CHECKS; + +-- ----------------------------------------------------- +-- Data for table `tom_3_2_sequence_info` +-- ----------------------------------------------------- +START TRANSACTION; +USE `tom_sequence`; +INSERT INTO `tom_3_2_sequence_info` (`gene_id`, `full_seq`, `full_seq_len`, `phyre_2_seq`, `phyre2_seq_start`, `phyre2_seq_end`) VALUES ('Solyc00g005445.1.1', 'MSIFSDKIEDTIEQPTDESRSLMLADNVYIHVLSAYKLWRKYSSKKQTRKIFLLIRKEVHKQIGCQYTGVTLSEWQLEYAKLRVERADLQVVLSFIVLFIATRKDLEEATKVVQEKMIVCRIEACRGVWTKVQEGALESSVI*', 143, 'KEVHKQIGCQYTGVTLSEWQLEYAKLRVERADLQVVLSFIVLFIATRKDLEEATKVVQEKMIVCRIEA', 57, 124); + +COMMIT; + diff --git a/config/init.sh b/config/init.sh index 50ad1b93..5e976d57 100755 --- a/config/init.sh +++ b/config/init.sh @@ -7,7 +7,7 @@ DB_USER="root" DB_PASS="root" # Load the data -echo "Welcome to the BAR API. Running init..." +echo "Welcome to the BAR API. Running init!" mysql -u $DB_USER -p$DB_PASS < ./config/databases/annotations_lookup.sql mysql -u $DB_USER -p$DB_PASS < ./config/databases/single_cell.sql @@ -17,6 +17,7 @@ mysql -u $DB_USER -p$DB_PASS < ./config/databases/poplar_nssnp.sql mysql -u $DB_USER -p$DB_PASS < ./config/databases/tomato_nssnp.sql mysql -u $DB_USER -p$DB_PASS < ./config/databases/eplant_poplar.sql mysql -u $DB_USER -p$DB_PASS < ./config/databases/eplant_tomato.sql +mysql -u $DB_USER -p$DB_PASS < ./config/databases/tomato_seq.sql echo "Data are now loaded. Preparing API config" echo "Please manually edit config file!" diff --git a/tests/resources/test_sequence.py b/tests/resources/test_sequence.py new file mode 100644 index 00000000..30a412d3 --- /dev/null +++ b/tests/resources/test_sequence.py @@ -0,0 +1,22 @@ +from api import app +from unittest import TestCase + + +class TestIntegrations(TestCase): + def setUp(self): + self.app_client = app.test_client() + + def test_get_gene_alias_list(self): + """This function tests the gene sequence endpoint + :return: + """ + response = self.app_client.get("/sequence/tomato/Solyc00g005445.1.1") + expected = { + "gene_id": "Solyc00g005445.1.1", + "sequence": "MSIFSDKIEDTIEQPTDESRSLMLADNVYIHVLSAYKLWRKYSSKKQTRKIFLLIRKEVHKQIGCQYTGVTLSEWQLEYAKLRVERADLQVVLSFIVLFIATRKDLEEATKVVQEKMIVCRIEACRGVWTKVQEGALESSVI*", + "length": 143, + "phyre_2_seq": "KEVHKQIGCQYTGVTLSEWQLEYAKLRVERADLQVVLSFIVLFIATRKDLEEATKVVQEKMIVCRIEA", + "phyre2_seq_start": 57, + "phyre2_seq_end": 124 + } + self.assertEqual(response.json, expected)